SPINT2 Antibody - C-terminal region : Biotin

SPINT2 Antibody - C-terminal region : Biotin
SKU
AVIARP59165_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: HAI-2 (SPINT2) is a candidate tumour suppressor gene that is frequently hypermethylated and underexpressed in human HCCs, and the KD-1 domain of HAI-2 is the key region responsible for its anti-invasive function. It is also implicated in human cervical cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPINT2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGDDKEQLVKNTY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kunitz-type protease inhibitor 2

Protein Size: 252

Purification: Affinity Purified
More Information
SKU AVIARP59165_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59165_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10653
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×