SRR Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SRR catalyzes the synthesis of D-serine from L-serine.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SRR

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine racemase

Protein Size: 340

Purification: Affinity Purified

• SKU: AVIARP57572_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57572_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 63826
• Host: Rabbit