SS18L1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific functin of this protein remains unknown.Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SS18L1

Key Reference: de Cytogenet. Genome Res. 112 (3-4), 222-226 (2006)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-responsive transactivator

Protein Size: 396

Purification: Affinity Purified

• SKU: AVIARP55923_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55923_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26039
• Host: Rabbit