SS18L1 Antibody - middle region : FITC

SS18L1 Antibody - middle region : FITC
SKU
AVIARP55923_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific functin of this protein remains unknown.Synovial sarcomas occur most frequently in the extremities around large joints. More than 90% of cases have a recurrent and specific chromosomal translocation, t(X;18)(p11.2;q11.2), in which the 5-prime end of the SS18 gene (MIM 600192) is fused in-frame to the 3-prime end of the SSX1 (MIM 312820), SSX2 (MIM 300192), or SSX4 (MIM 300326) gene. The SS18L1 gene is homologous to SS18.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SS18L1

Key Reference: de Cytogenet. Genome Res. 112 (3-4), 222-226 (2006)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EYYGEQYSHSQGAAEPMGQQYYPDGHGDYAYQQSSYTEQSYDRSFEESTQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium-responsive transactivator

Protein Size: 396

Purification: Affinity Purified
More Information
SKU AVIARP55923_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55923_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26039
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×