SSBP3 Antibody - middle region : FITC

SSBP3 Antibody - middle region : FITC
SKU
AVIARP55355_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SSBP3 may be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSBP3

Key Reference: Adams,M.D., (2006) Biochem. Biophys. Res. Commun. 339 (3), 977-984

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: DIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Single-stranded DNA-binding protein 3

Protein Size: 368

Purification: Affinity Purified
More Information
SKU AVIARP55355_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55355_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23648
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×