STK32A Antibody - N-terminal region : FITC

STK32A Antibody - N-terminal region : FITC
SKU
AVIARP55655_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK32A

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein kinase 32C

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP55655_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55655_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 202374
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×