STK32A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human STK32A

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase 32C

Protein Size: 358

Purification: Affinity Purified

• SKU: AVIARP55655_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55655_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 202374
• Host: Rabbit