SUMO3 Antibody - middle region : FITC

SUMO3 Antibody - middle region : FITC
SKU
AVIARP58247_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUMO3

Key Reference: Zhang,X.D., (2008) Mol. Cell 29 (6), 729-741

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Small ubiquitin-related modifier 3

Protein Size: 103

Purification: Affinity Purified
More Information
SKU AVIARP58247_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58247_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 6612
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×