SUN3 Antibody - C-terminal region : HRP

SUN3 Antibody - C-terminal region : HRP
SKU
AVIARP54471_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SUN3

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TGTTVQTFELQHAVSEYLLCVKLNIFSNWGHPKYTCLYRFRVHGTPGKHI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SUN domain-containing protein 3

Protein Size: 269

Purification: Affinity Purified
More Information
SKU AVIARP54471_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54471_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256979
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×