SUNC1 Antibody - C-terminal region : FITC

SUNC1 Antibody - C-terminal region : FITC
SKU
AVIARP54470_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUNC1

Key Reference: Osada,N., (er) BMC Genomics 3 (1), 36 (2002)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SUN domain-containing protein 3

Protein Size: 357

Purification: Affinity Purified
More Information
SKU AVIARP54470_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54470_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256979
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×