SUNC1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SUNC1

Key Reference: Osada,N., (er) BMC Genomics 3 (1), 36 (2002)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SUN domain-containing protein 3

Protein Size: 357

Purification: Affinity Purified

• SKU: AVIARP54470_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54470_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 256979
• Host: Rabbit