SUR2A Antibody, Clone N319A/14: APC

Mouse Anti-Mouse SUR2A Monoclonal IgG2A
SKU
STRSMC-431D-APC
Packaging Unit
100 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: SUR2A

Conjugate: APC

Product Type: Monoclonal

Clone Number: N319A/14 (Formerly sold as S319A-14)

Immunogen: Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A

Swiss-Prot: P70170

Purification: Protein G Purified

Storage Buffer: PBS pH7.4, 50% glycerol, 0.1% sodium azide *Storage buffer may change when conjugated

Concentration: 1 mg/ml

Specificity: Detects ~120kDa. Does not cross-react with SUR2B.

Cellular Localization: Membrane

Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2).

References: 1. Campbell J.D., Sansom M.S., Ashcroft F.M. (2003) EMBO Resp. 4(11): 1038-1042.2. Nichols C.G. (2006) Nature. 440 (7083): 470-476.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
More Information
SKU STRSMC-431D-APC
Manufacturer Stressmarq Biosciences
Manufacturer SKU SMC-431D-APC
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Monoclonal
Application Immunofluorescence, Western Blotting, Immunohistochemistry, Immunocytochemistry
Isotype IgG2a
Human Gene ID 20928
Host Mouse
Product information (PDF) Download
MSDS (PDF) Download