SYCP3 Antibody - N-terminal region : FITC

SYCP3 Antibody - N-terminal region : FITC
SKU
AVIARP58335_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SYCP3

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: KYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Synaptonemal complex protein 3

Protein Size: 236

Purification: Affinity Purified
More Information
SKU AVIARP58335_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58335_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50511
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×