TAF1 (BD2), His-tag Recombinant

TAF1 (BD2), His-tag Recombinant
SKU
BPS31110
Packaging Unit
100 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 1519 - 1651

Amino Acid Sequence: MHHHHHHLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEAE

Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

Description: Human Bromodomain TAF1, GenBank Accession No. NM_004606, a.a. 1519 - 1651 corresponding to bromodomain 2 with N-terminal His-tag, MW = 16.4 kDa, expressed in an E. coli expression system.

Format: Aqueous buffer solution

Formulation: 40 mM Tris-HCl, pH8.0, 110 mM NaCl, 2.2 mM KCl, 0.04% Tween-20, 20% glycerol

Genbank: NM_004606

Storage Stability: At least 6 months at -80°C.

Tags: N-terminal His-tag

Uniprot: P21675

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Sako W, ,et al., Neuroscience. 2011 Aug 25;189:100-7.
2. Zaborowska J, et al., Transcription. 2012 Mar 1;3(2).
More Information
SKU BPS31110
Manufacturer BPS Bioscience
Manufacturer SKU 31110
Green Labware No
Package Unit 100 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF)
×