TASP1 Antibody - middle region : FITC

TASP1 Antibody - middle region : FITC
SKU
AVIARP57018_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an endopeptidase that cleaves specific substrates following aspartate residues. The encoded protein undergoes posttranslational autoproteolytic processing to generate alpha and beta subunits, which reassemble into the active alpha2-beta2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TASP1

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Threonine aspartase 1

Protein Size: 420

Purification: Affinity Purified
More Information
SKU AVIARP57018_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57018_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55617
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×