TBC1D25 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of HUMAN TBC1D25

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: STFEDAVDHLATASQGPGGGGRLLRQASLDGLQQLRDNMGSRRDPLVQLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified

• SKU: AVIARP56370_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56370_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4943
• Host: Rabbit