TBC1D25 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with a TBC domain and may function as a Rab GTPase activating protein. This gene was previously known as ornithine aminotransferase-like 1, but has no similarity to ornithine aminotransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D25

Key Reference: Aizawa,T., (2003) Biochim. Biophys. Acta 1603 (2), 47-82

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 25

Protein Size: 688

Purification: Affinity Purified

• SKU: AVIARP56369_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56369_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4943
• Host: Rabbit