TBCCD1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBCCD1

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBCC domain-containing protein 1

Protein Size: 557

Purification: Affinity Purified

• SKU: AVIARP57123_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57123_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55171
• Host: Rabbit