TBK1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitinat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBK1

Key Reference: Morton,S., (2008) FEBS Lett. 582 (6), 997-1002

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase TBK1

Protein Size: 729

Purification: Affinity Purified

• SKU: AVIARP54922_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54922_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29110
• Host: Rabbit