TCF7L1 Antibody - N-terminal region : HRP

TCF7L1 Antibody - N-terminal region : HRP
SKU
AVIARP57917_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TCF7L1 participates in the Wnt signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It is necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis. TCF7L1 down-regulates NQO1, leading to increased mitomycin c resistance.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L1

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor 7-like 1

Protein Size: 588

Purification: Affinity Purified
More Information
SKU AVIARP57917_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57917_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 83439
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×