TCL1A Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCL1A

Key Reference: Herling,M., (2008) Blood 111 (1), 328-337

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell leukemia/lymphoma protein 1A

Protein Size: 114

Purification: Affinity Purified

• SKU: AVIARP58808_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58808_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 8115
• Host: Rabbit
• Conjugate: Conjugated, Biotin