TCL1A Antibody - N-terminal region : FITC

TCL1A Antibody - N-terminal region : FITC
SKU
AVIARP58808_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3;promote nuclear translocation of AKT1;enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCL1A

Key Reference: Herling,M., (2008) Blood 111 (1), 328-337

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-cell leukemia/lymphoma protein 1A

Protein Size: 114

Purification: Affinity Purified
More Information
SKU AVIARP58808_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58808_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8115
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×