TCP11L2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of TCP11L2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCP11L2

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 2

Protein Size: 519

Purification: Affinity Purified

• SKU: AVIARP55541_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55541_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 255394
• Host: Rabbit