Tdp1 Antibody - middle region : Biotin

Tdp1 Antibody - middle region : Biotin
SKU
AVIARP57199_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Tdp1 is a DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. It catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. It hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. It acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. It has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. It has no exonuclease activity towards DNA or RNA with a 3'phosphate.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 579

Purification: Affinity Purified
More Information
SKU AVIARP57199_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57199_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 104884
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×