Tekt3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tektin-3

Protein Size: 490

Purification: Affinity Purified

• SKU: AVIARP57677_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57677_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 287392
• Host: Rabbit