TESC Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TESC

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcineurin B homologous protein 3

Protein Size: 214

Purification: Affinity Purified

• SKU: AVIARP57060_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57060_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54997
• Host: Rabbit