TESC Antibody - N-terminal region : Biotin

TESC Antibody - N-terminal region : Biotin
SKU
AVIARP57059_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human TESC

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: calcineurin B homologous protein 3

Protein Size: 267

Purification: Affinity Purified
More Information
SKU AVIARP57059_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57059_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54997
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×