TEX19 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TEX19 is required during spermatogenesis and placenta development, probably by participating to the repression of retrotransposable elements and prevent their mobilization (By similarity). .

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TEX19

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: MEHTEAESEQEGSSGMELSWGQSPGQPVQGGSEAWGPGTLAAAPEGLEDA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testis-expressed sequence 19 protein

Protein Size: 164

Purification: Affinity Purified

• SKU: AVIARP56004_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56004_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 400629
• Host: Rabbit