Tfam Antibody - middle region : Biotin

Tfam Antibody - middle region : Biotin
SKU
AVIARP58722_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor A, mitochondrial

Protein Size: 243

Purification: Affinity Purified
More Information
SKU AVIARP58722_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58722_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Mouse (Murine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 21780
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×