Tfam Antibody - middle region : Biotin

Tfam Antibody - middle region : Biotin
SKU
AVIARP58723_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor A, mitochondrial

Protein Size: 243

Purification: Affinity Purified
More Information
SKU AVIARP58723_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58723_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Mouse (Murine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 21780
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×