TFAP2B Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B

Key Reference: Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor AP-2-beta

Protein Size: 460

Purification: Affinity Purified

• SKU: AVIARP57907_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57907_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7021
• Host: Rabbit