TFAP2B Antibody - N-terminal region : HRP

TFAP2B Antibody - N-terminal region : HRP
SKU
AVIARP57907_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TFAP2B belongs to the AP-2 family which is developmentally regulated and have distinct overlapping functions in the regulation of many genes governing growth and differentiation. TFAP2B binds DNA as a dimmer and can form homodimers or heterodimers with other AP-2 family members. It may be a candidate for conferring susceptibility to type 2 didabetes. This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 AU141084.1 1-144 145-1684 BC037225.1 1-1540 1685-5370 AL049693.16 11928-15613 5371-5770 BU738725.1 18-417 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B

Key Reference: Hensch,T., (2008) Neurosci. Lett. 436 (1), 67-71

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor AP-2-beta

Protein Size: 460

Purification: Affinity Purified
More Information
SKU AVIARP57907_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57907_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7021
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×