TGFB3 Antibody - middle region : HRP

TGFB3 Antibody - middle region : HRP
SKU
AVIARP59157_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TGFB3 is involved in embryogenesis and cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transforming growth factor beta-3

Protein Size: 412

Purification: Affinity Purified
More Information
SKU AVIARP59157_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59157_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7043
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×