Thap11 Antibody - C-terminal region : FITC

Thap11 Antibody - C-terminal region : FITC
SKU
AVIARP58803_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Thap11 is a rranscriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. It is also a sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: AAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: THAP domain-containing protein 11

Protein Size: 305

Purification: Affinity Purified
More Information
SKU AVIARP58803_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58803_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 59016
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×