THAP12 Antibody - N-terminal region : Biotin

THAP12 Antibody - N-terminal region : Biotin
SKU
AVIARP56594_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIR

Key Reference: Lee,J.H., (2003) Korean J Gastroenterol 42 (6), 484-495

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 52 kDa repressor of the inhibitor of the protein kinase

Protein Size: 761

Purification: Affinity Purified
More Information
SKU AVIARP56594_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56594_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5612
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×