THAP12 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIR

Key Reference: Lee,J.H., (2003) Korean J Gastroenterol 42 (6), 484-495

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 52 kDa repressor of the inhibitor of the protein kinase

Protein Size: 761

Purification: Affinity Purified

• SKU: AVIARP56594_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56594_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5612
• Host: Rabbit