THEG Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THEG

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testicular haploid expressed gene protein

Protein Size: 355

Purification: Affinity Purified

• SKU: AVIARP57810_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57810_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51298
• Host: Rabbit