THPO Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THPO

Key Reference: Baker,J.E., (2008) Cardiovasc. Res. 77 (1), 44-53

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thrombopoietin

Protein Size: 353

Purification: Affinity Purified

• SKU: AVIARP58735_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58735_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7066
• Host: Rabbit
• Conjugate: Conjugated, Biotin