THYN1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human THYN1

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Thymocyte nuclear protein 1

Protein Size: 225

Purification: Affinity Purified

• SKU: AVIARP54987_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54987_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 29087
• Host: Rabbit