Timm13 Antibody - N-terminal region : FITC

Timm13 Antibody - N-terminal region : FITC
SKU
AVIARP54905_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Timm13 is a mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. It is also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial import inner membrane translocase subunit Tim13

Protein Size: 95

Purification: Affinity Purified

Subunit: Tim13
More Information
SKU AVIARP54905_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54905_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 30055
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×