TIMP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIMP2

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: IVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Metalloproteinase inhibitor 2

Protein Size: 220

Purification: Affinity Purified

• SKU: AVIARP59181_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59181_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7077
• Host: Rabbit
• Conjugate: Conjugated, Biotin