TIMP3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIMP3

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Metalloproteinase inhibitor 3

Protein Size: 211

Purification: Affinity Purified

• SKU: AVIARP59182_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59182_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 7078
• Host: Rabbit
• Conjugate: Conjugated, HRP