TINAG Antibody - middle region : Biotin

TINAG Antibody - middle region : Biotin
SKU
AVIARP55063_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAG

Molecular Weight: 54

Peptide Sequence: Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulointerstitial nephritis antigen

Protein Size: 476

Purification: Affinity Purified
More Information
SKU AVIARP55063_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55063_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27283
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×