TINAGL1 Antibody - middle region : Biotin

TINAGL1 Antibody - middle region : Biotin
SKU
AVIARP57621_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAGL1

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulointerstitial nephritis antigen-like

Protein Size: 467

Purification: Affinity Purified
More Information
SKU AVIARP57621_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57621_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64129
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×