TINAGL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TINAGL1 may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells. This is a non catalytic peptidase C1 family protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAGL1

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulointerstitial nephritis antigen-like

Protein Size: 467

Purification: Affinity Purified

• SKU: AVIARP57621_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57621_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 64129
• Host: Rabbit