TINF2 Antibody - middle region : FITC

TINF2 Antibody - middle region : FITC
SKU
AVIARP58338_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINF2

Key Reference: Kim,S.H., (2008) J. Cell Biol. 181 (3), 447-460

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TERF1-interacting nuclear factor 2

Protein Size: 451

Purification: Affinity Purified
More Information
SKU AVIARP58338_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58338_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26277
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×