TLR8 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TLR8

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: LEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Toll-like receptor 8

Protein Size: 1041

Purification: Affinity Purified

• SKU: AVIARP59048_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59048_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51311
• Host: Rabbit
• Conjugate: Conjugated, Biotin