TLR8 Antibody - C-terminal region : HRP

TLR8 Antibody - C-terminal region : HRP
SKU
AVIARP59048_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TLR8

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: LEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Toll-like receptor 8

Protein Size: 1041

Purification: Affinity Purified
More Information
SKU AVIARP59048_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59048_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51311
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×