TM9SF1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: TM9SF1 may function as channel, small molecule transporter or receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TM9SF1

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: LVGFVAVILMRVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane 9 superfamily member 1

Protein Size: 489

Purification: Affinity Purified

• SKU: AVIARP58962_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58962_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10548
• Host: Rabbit
• Conjugate: Conjugated, Biotin