TMCO4 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of TMCO4 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO4

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane and coiled-coil domain-containing protein 4

Protein Size: 634

Purification: Affinity Purified

• SKU: AVIARP55797_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55797_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 255104
• Host: Rabbit